Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597692.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 834aa    MW: 92472 Da    PI: 4.8863
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597692.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e+lF+++++p+ ++r +L++ lgL+ rqVk+WFqNrR+++k
                     688899***********************************************998 PP

           START   4 eeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     ++ ++elvk+ +a++p+W +    + g+evl  +e s+               ++ea r s+vv+m++ +lv  lld + +W e ++    +a+t
                     6789*****************9..5566666665555556666679999999***************************.*************** PP

           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                     ++v++sg      g lqlm++e+qal+plvp R+ +f+Ry++q  ++g+w+ivd  +ds  ++   +++   ++++Sg++i++++ng+s+vtwve
                     *******************************************99***************9998.58888888********************** PP

           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++ + +++++ v+sg+a+ga++w+  lqrqce+
                     ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.58496156IPR001356Homeobox domain
SMARTSM003895.8E-1997160IPR001356Homeobox domain
PfamPF000461.1E-1799154IPR001356Homeobox domain
CDDcd000866.00E-1899157No hitNo description
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084841.584292530IPR002913START domain
SuperFamilySSF559612.33E-32293529No hitNo description
CDDcd088751.99E-112296526No hitNo description
SMARTSM002341.9E-30301527IPR002913START domain
PfamPF018522.7E-41304527IPR002913START domain
SuperFamilySSF559616.18E-18553723No hitNo description
SuperFamilySSF559616.18E-18756795No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597691.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_009597692.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_009597693.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0V0IWB50.0A0A0V0IWB5_SOLCH; Putative homeobox-leucine zipper protein HDG5-like
STRINGSolyc08g076370.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description